Cathelicidin peptide (research)
LL-37
Lyophilized research peptide
Human cathelicidin antimicrobial peptide LL-37 (37 residues). Widely studied in vitro for membrane interaction and innate-immunity research. Lyophilized, ≥99% HPLC. Research use only.
Lab name and RUO acknowledgment are collected at checkout.
Lot documentation
Every shipment includes the lot-specific certificate of analysis — HPLC purity (≥99% typical), mass-spec identity, net peptide content, water content, and residual solvents.
Identity & specifications
- Common name
- LL-37 / hCAP-18
- Sequence
- [LL-37, 37 aa]
- Length
- 37 residues
- Molecular weight
- 4,493.3 g/mol
- Net charge (pH 7)
- +6
- Appearance
- White lyophilized powder
- Purity (HPLC)
- ≥ 99%
- Solubility
- Soluble in bacteriostatic water; near-neutral buffers preferred
LL-37 in research
LL-37 is the only known cathelicidin in humans, generated by proteolytic processing of hCAP-18. The peptide has been extensively studied in vitro for amphipathic α-helical conformation, membrane interaction, and modulation of pattern-recognition receptors. Published research uses LL-37 as a reference peptide in innate-immunity, biofilm, and structure-activity studies.
Purity and characterization
Our LL-37 ships at ≥99% HPLC purity with mass-spectrometry identity verification. Net peptide content (excluding water and counter-ion mass) is reported on the certificate of analysis — important for accurate concentration calculations in MIC and binding-assay work.
Storage and reconstitution notes
Hold lyophilized vials at -20 °C in original packaging away from light. Reconstitute in lab-grade water or near-neutral buffer; LL-37 is amphipathic and labs report best stability when working volumes are aliquoted and frozen on first reconstitution. Avoid plastic containers known to adsorb cationic peptides without a carrier.
Documentation
CoA covers identity (MS), purity (HPLC), and net-peptide content. Batch records by lot are available for compliance and audit retrieval.
Research guide
LL-37 research overview
LL-37 is a research-use-only material for qualified laboratory programs. This page summarizes identity fields, storage and handling, CoA review, and linked research resources for procurement and QA.
Catalog class: Cathelicidin peptide (research).
Key identity fields
- Common name
- LL-37 / hCAP-18
- Sequence
- [LL-37, 37 aa]
- Length
- 37 residues
- Molecular weight
- 4,493.3 g/mol
- Net charge (pH 7)
- +6
- Appearance
- White lyophilized powder
Storage and handling
Handle LL-37 as a lyophilized research reagent: cold, dry, light-protected storage; choose reconstitution buffer per your SOP; plan aliquots to limit freeze–thaw; and keep the lot CoA with the inventory record.
Research framing
Use LL-37 in published model-system terms only — receptor family, pathway context, assay controls, and concentration planning. Do not transfer assumptions from adjacent peptides without a documented comparison protocol. Research use only.
Documentation checklist
- Storage and stability records for the received lot
- Lot CoA with HPLC, MS identity, and net peptide content
- Literature and assay context filed with the protocol
- Verify lots in the CoA Library
Product FAQ
Is LL-37 intended for human or clinical use?
No. BluGen listings are research use only (RUO) for qualified laboratory programs — not clinical, diagnostic, therapeutic, veterinary, food, drug, or cosmetic use.
What documentation ships with LL-37?
Each lot includes a certificate of analysis with HPLC purity, MS identity confirmation, and net peptide content. Verify lots in the CoA Library.
Where can I verify the current-lot CoA for LL-37?
Search by compound or lot number in the CoA Library: https://getblugen.com/coa-library/
What sequence is listed for LL-37?
The listed sequence is [LL-37, 37 aa] Confirm against the lot-specific CoA before release into inventory.
How should lyophilized LL-37 be stored?
Store sealed vials cold, dry, and protected from light per the lot CoA and your institutional SOP. Aliquot reconstituted stock to limit freeze-thaw cycles.
Can institutions request a quote for LL-37?
Yes. Academic labs and CROs can request quotes and NET-30 billing after vendor qualification via the contact/procurement desk.
Where is the research guide for LL-37?
See the BluGen research guide for literature context, storage notes, and comparisons: https://getblugen.com/research/research-guide-ll-37/
Related research resources
- LL-37 research guide
- Research peptide glossary
- Peptide reconstitution guide
- Peptide storage and reconstitution guide
- How to read a peptide CoA
- HPLC, MS, and net peptide content guide
- Research use only procurement guide
- Related comparison guide
- How to verify a peptide lot
- Supplier evaluation checklist
- Documentation hub
- Sample CoA field guide
Lab checklist
- Confirm lot CoA: HPLC purity, MS identity, and net peptide content before release.
- Record storage, reconstitution, concentration, and aliquot history per your SOP.
- Reconstitution calculator
- Documentation & verification hub
- Search PubMed for LL-37 research
Research use only (RUO)
This material is sold for laboratory research purposes only. It is not for clinical, diagnostic, therapeutic, or veterinary application, and not for food, drug, or cosmetic use where restricted.
Related research & procurement docs
Research-use-only guides, comparisons, and procurement briefs tagged to this compound.