Cathelicidin peptide (research)
LL-37
Lyophilized research peptide
Human cathelicidin antimicrobial peptide LL-37 (37 residues). Widely studied in vitro for membrane interaction and innate-immunity research. Lyophilized, ≥99% HPLC. Research use only.
Lab name and RUO acknowledgment are collected at checkout.
Lot documentation
Every shipment includes the lot-specific certificate of analysis — HPLC purity (≥99% typical), mass-spec identity, net peptide content, water content, and residual solvents.
Identity & specifications
- Common name
- LL-37 / hCAP-18
- Sequence
- [LL-37, 37 aa]
- Length
- 37 residues
- Molecular weight
- 4,493.3 g/mol
- Net charge (pH 7)
- +6
- Appearance
- White lyophilized powder
- Purity (HPLC)
- ≥ 99%
- Solubility
- Soluble in bacteriostatic water; near-neutral buffers preferred
LL-37 in research
LL-37 is the only known cathelicidin in humans, generated by proteolytic processing of hCAP-18. The peptide has been extensively studied in vitro for amphipathic α-helical conformation, membrane interaction, and modulation of pattern-recognition receptors. Published research uses LL-37 as a reference peptide in innate-immunity, biofilm, and structure-activity studies.
Purity and characterization
Our LL-37 ships at ≥99% HPLC purity with mass-spectrometry identity verification. Net peptide content (excluding water and counter-ion mass) is reported on the certificate of analysis — important for accurate concentration calculations in MIC and binding-assay work.
Storage and reconstitution notes
Hold lyophilized vials at -20 °C in original packaging away from light. Reconstitute in lab-grade water or near-neutral buffer; LL-37 is amphipathic and labs report best stability when working volumes are aliquoted and frozen on first reconstitution. Avoid plastic containers known to adsorb cationic peptides without a carrier.
Documentation
CoA covers identity (MS), purity (HPLC), and net-peptide content. Batch records by lot are available for compliance and audit retrieval.
Research guide
LL-37 research overview
LL-37 is listed as a research-use-only material for qualified laboratory programs. This page connects the product listing with identity fields, storage context, CoA review, and long-form research resources so procurement and QA reviewers can evaluate the SKU without relying on a thin commerce page.
The catalog classifies this material as Cathelicidin peptide (research), which helps labs compare it with adjacent research peptides, organize internal inventory, and build study-specific reference groups.
Key identity fields
- Common name
- LL-37 / hCAP-18
- Sequence
- [LL-37, 37 aa]
- Length
- 37 residues
- Molecular weight
- 4,493.3 g/mol
- Net charge (pH 7)
- +6
- Appearance
- White lyophilized powder
Storage and handling context
For long-tail stability searches, LL-37 should be evaluated in the context of lyophilized storage, reconstitution buffer choice, aliquot planning, freeze-thaw limits, and lot-specific CoA conditions. Always follow institutional SOPs and the documentation attached to the received lot.
Mechanism context
LL-37 should be described through published model-system language: receptor family, pathway context, assay controls, concentration planning, and lot traceability. Avoid transferring assumptions from adjacent peptides without a documented comparison protocol.
Search intent covered
- LL-37 storage and stability
- LL-37 CoA and identity
- LL-37 mechanism research
- LL-37 comparison resources
Product FAQ
Is LL-37 intended for clinical programs?
No. BluGen listings are research use only (RUO) materials for qualified laboratory programs, not clinical, diagnostic, therapeutic, veterinary, food, drug, or cosmetic use.
What documentation is available for LL-37?
Lot-level documentation may include CoA, HPLC purity, MS identity confirmation, net peptide content, and batch records where available for the SKU and lot.
How should lyophilized LL-37 be stored?
Store sealed lyophilized vials cold, dry, and protected from light unless the lot CoA or institutional SOP specifies another condition. Reconstituted material should be aliquoted according to the lab protocol.
Where can I learn more about LL-37 research context?
See the BluGen research guide for mechanism context, stability notes, storage considerations, and related peptide comparisons: https://getblugen.com/research/research-guide-ll-37/
What is the research category for LL-37?
LL-37 is categorized as Cathelicidin peptide (research) for catalog organization, internal linking, and related research comparisons.
What sequence is listed for LL-37?
The listed sequence for LL-37 is [LL-37, 37 aa] Always verify sequence and identity against the lot-specific CoA before use in a research workflow.
What molecular weight is listed for LL-37?
The listed molecular weight for LL-37 is 4,493.3 g/mol. Use the lot CoA and net peptide content when calculating research stock concentrations.
Does LL-37 require cold storage?
Most lyophilized research peptides are stored cold, dry, sealed, and protected from light unless the lot CoA or institutional SOP states otherwise.
How should reconstituted LL-37 be handled?
Reconstituted research stocks should be labeled with SKU, lot, solvent, concentration, date, and technician initials, then aliquoted according to the lab protocol to limit freeze-thaw history.
Can lots of LL-37 be mixed together?
Avoid mixing lots unless a written protocol requires it. Mixed-lot stocks reduce traceability and make CoA review more difficult.
What purity documentation matters for LL-37?
HPLC purity, MS identity, net peptide content, moisture or residual summaries where available, and lot number alignment are the core documentation checks.
What does net peptide content mean for LL-37?
Net peptide content accounts for peptide mass apart from water and counter-ion contribution. It is important for molarity calculations in laboratory records.
What should procurement review before ordering LL-37?
Procurement should review SKU, vial size, lot documentation path, RUO status, storage requirements, shipping expectations, and any internal approval requirements.
How should LL-37 be cited in a method record?
Record supplier, SKU, lot number, CoA document ID, reconstitution solvent, stock concentration, storage condition, and date prepared.
What are common related resources for LL-37?
Related resources include the peptide storage guide, reconstitution guide, CoA reading guide, purity guide, and any comparison articles linked from the product page.
Why does BluGen link LL-37 to research articles?
Internal article links help buyers evaluate identity, storage, documentation, and research context without relying on a thin product listing.
What should be done if LL-37 documentation is incomplete?
Hold the lot in review and request the missing CoA or batch documentation before releasing the material into an internal research workflow.
Is LL-37 content on BluGen medical advice?
No. BluGen content is laboratory procurement and research documentation content for RUO materials only.
Related research resources
Reference path
- Lot CoA: verify HPLC purity, MS identity, and net peptide before release.
- Internal SOP: record storage, reconstitution, concentration, and aliquot history.
- Reconstitution calculator: convert vial size + diluent to concentration
- Article links: file the product guide, glossary definition, storage guide, and comparison page beside procurement notes.
- Search PubMed for LL-37 research
Research use only (RUO)
This material is sold for laboratory research purposes only. It is not for clinical, diagnostic, therapeutic, or veterinary application, and not for food, drug, or cosmetic use where restricted.